Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CKMT1B Antibody

CKMT1B antibody LS-C408648 is an unconjugated rabbit polyclonal antibody to CKMT1B from human, mouse and rat. Validated for IHC and WB.
50 µl
100 µl
200 µl
CKMT1B antibody LS-C408648 is an unconjugated rabbit polyclonal antibody to CKMT1B from human, mouse and rat. Validated for IHC and WB.
Human CKMT1B
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CKMT1B antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Human CKMT1B
The predicted MW is 47kDa/50kDa, while the observed MW by Western blot was 47kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CKMT1B
P12532 NM_020990 NP_066270.1

Popular CKMT1B Products

Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a concentration of 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8.Lane 1: CKMT1B transfected lysate(47 KDa).Lane 2: Non-transfected lysate.
Species: Human
Applications: Western blot, ELISA, RNA interference
Western blot detection of CKMT1 in Mouse Colon, 293 and A431 cell lysates using CKMT1 mouse monoclonal antibody (1:1000 dilution). Predicted band size: 47KDa. Observed band size:47KDa.
Species: Human, Mouse
Applications: Western blot
The anti-CKMT1 antibody is used in Western blot to detect CKMT1 in mouse colon tissue lysate (Lane 1) and ZR-75-1 cell lysate (Lane 2).
Species: Human, Mouse
Applications: Western blot

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 1/21/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy