Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662944-10 10 µg $318 
LS-C662944-100 100 µg $470 
CHRNA3 Antibody - Western blot analysis of CHRNA3 using anti-CHRNA3 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates,Lane 2: human MDA-MB-453 whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human SK-OV-3 whole cell lysates,Lane 6: human PANC-1 whole cell lysates,Lane 7: mouse thymus tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA3 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA3 at approximately 60KD. The expected band size for CHRNA3 is at 57KD.
CHRNA3 Antibody - Western blot analysis of CHRNA3 using anti-CHRNA3 antibody
CHRNA3 Antibody - Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody. Overlay histogram showing U-87 cells stained with anti-CHRNA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CHRNA3 Antibody - Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody. Overlay histogram showing U251 cells stained with anti-CHRNA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CHRNA3 Antibody - Western blot analysis of CHRNA3 using anti-CHRNA3 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates,Lane 2: human MDA-MB-453 whole cell lysates,Lane 3: human Jurkat whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human SK-OV-3 whole cell lysates,Lane 6: human PANC-1 whole cell lysates,Lane 7: mouse thymus tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CHRNA3 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CHRNA3 at approximately 60KD. The expected band size for CHRNA3 is at 57KD.
CHRNA3 Antibody - Western blot analysis of CHRNA3 using anti-CHRNA3 antibody
CHRNA3 Antibody - Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody. Overlay histogram showing U-87 cells stained with anti-CHRNA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CHRNA3 Antibody - Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody. Overlay histogram showing U251 cells stained with anti-CHRNA3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CHRNA3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human CHRNA3 Antibody (IHC, WB) LS‑C662944

Polyclonal Rabbit anti‑Human CHRNA3 Antibody (IHC, WB) LS‑C662944

Antibody:
CHRNA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662944-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CHRNA3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CHRNA3 antibody LS-C662944 is an unconjugated rabbit polyclonal antibody to human CHRNA3. Validated for Flow, ICC, IHC and WB.
Target
Human CHRNA3
Synonyms
CHRNA3 | AChR-alpha3 | Acra-3 | LNCR2 | NAChR alpha 3 | PAOD2 | NACHRA3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
Applications
  • IHC
  • IHC - Frozen
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CHRNA3
P32297 NM_000743 NP_000734.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/6/2024