Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782869-100 100 µg $575 
CHM / REP1 Antibody - IHC staining of FFPE human placenta with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE mouse small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE rat small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human thyroid cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human intestinal cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human lung cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IF/ICC staining of FFPE human A431 cells with CHM antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
CHM / REP1 Antibody - Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
CHM / REP1 Antibody - IHC staining of FFPE human placenta with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE mouse small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE rat small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human thyroid cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human intestinal cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IHC staining of FFPE human lung cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CHM / REP1 Antibody - IF/ICC staining of FFPE human A431 cells with CHM antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
CHM / REP1 Antibody - Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human CHM / REP1 Antibody (IHC, IF, WB) LS‑C782869

Polyclonal Rabbit anti‑Human CHM / REP1 Antibody (IHC, IF, WB) LS‑C782869

Antibody:
CHM / REP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, IF, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782869-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CHM / REP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, IF, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
REP1 antibody LS-C782869 is an unconjugated rabbit polyclonal antibody to REP1 (CHM) from human. It is reactive with human, mouse and rat. Validated for Flow, IF, IHC and WB.
Target
Human CHM / REP1
Synonyms
CHM | Choroideraemia protein | DXS540 | GGTA | HSD-32 | REP-1 | REP1 | Rab escort protein 1 | TCD | TCD protein
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Immunofluorescence (2 - 4 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the CHM antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CHM / REP1
P24386 NM_000390 NP_000381.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/29/2024