LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CEACAM4 Antibody LS‑C496767
CEACAM4 antibody LS-C496767 is an unconjugated rabbit polyclonal antibody to human CEACAM4. Validated for WB.
Catalog
Size
Price
LS-C496767-50
50 µl
$235
LS-C496767-100
100 µl
$295
LS-C496767-200
200 µl
$385

Popular CEACAM4 Products

Immunohistochemistry of paraffin-embedded human colon cancer at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human colon cancer at dilution 1:100
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA
CEACAM4 antibody Western blot of Fetal Lung lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey
Applications: Western blot

Product Description

CEACAM4 antibody LS-C496767 is an unconjugated rabbit polyclonal antibody to human CEACAM4. Validated for WB.

Specifications

Target
Human CEACAM4
Synonyms
CEACAM4, Carcinoembryonic antigen CGM7, CGM7, NCA, CGM7_HUMAN
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:1000)
Immunogen
CEACAM4 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 36-155 of human CEACAM4 (NP_001808.2). FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Usage
The predicted MW is 25kDa, while the observed MW by Western blot was 24kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About CEACAM4
O75871 NM_001817 NP_001808.2


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Requested From: United States
Date Requested: 11/14/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy