Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CEACAM4 Antibody LS-C496767

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

CEACAM4 Antibody LS-C496767

Rabbit Polyclonal to Human CEACAM4
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human CEACAM4
Unconjugated, Unmodified


CEACAM4 antibody LS-C496767 is an unconjugated rabbit polyclonal antibody to human CEACAM4. Validated for WB.

Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:1000)
CEACAM4 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 36-155 of human CEACAM4 (NP_001808.2). FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
The predicted MW is 25kDa, while the observed MW by Western blot was 24kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
O75871 NM_001817 NP_001808.2

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 1.56-100 ng/ml
Species: Human
Applications: IHC, IHC - Paraffin
Reactivity: Human
Range: 15.63-1000 pg/ml
Reactivity: Human
Range: 31.2-2000 pg/ml

Requested From: United States
Date Requested: 6/17/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy