LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CD55 Antibody LS‑C331374
CD55 antibody LS-C331374 is an unconjugated rabbit polyclonal antibody to CD55 from human and mouse. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C331374-50
50 µl
$235
LS-C331374-100
100 µl
$315
LS-C331374-200
200 µl
$425
Description
CD55 antibody LS-C331374 is an unconjugated rabbit polyclonal antibody to CD55 from human and mouse. Validated for IF, IHC and WB.
Target
Human CD55
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CD55 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human CD55 (NP_000565.1). PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
Specificity
Human CD55
Usage
The predicted MW is 39kDa/41kDa/48kDa/56kDa/59kDa, while the observed MW by Western blot was 50kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About CD55
P08174 NM_000574 NP_000565.1

Popular CD55 Products

Antibody
Species: Human
Applications: Western blot
Anti-CD55 antibody IHC of human vessels. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Flow Cytometry
Anti-CD55 antibody IHC of human skin, pilosebaceous unit. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Non-Human Primates
Applications: IHC, IHC - Paraffin, Immunoprecipitation, Flow Cytometry
Antibody
Species: Human
Applications: IHC, IHC - Frozen, Flow Cytometry
Antibody
Species: Mouse
Applications: Western blot, Flow Cytometry, ELISA

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Immunofluorescence

Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Immunofluorescence

Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Immunofluorescence

Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A549 cells using CD55 antibody. Blue: DAPI for nuclear staining.

Western blot

Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of various cell lines, using CD55 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Requested From: United States
Date Requested: 11/20/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy