Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CD118 / LIF Receptor Alpha Antibody (aa863-899)

LIF Receptor Alpha antibody LS-C407873 is an unconjugated rabbit polyclonal antibody to LIF Receptor Alpha (CD118) from human, guinea pig and rabbit. Validated for WB.
100 µg
LIF Receptor Alpha antibody LS-C407873 is an unconjugated rabbit polyclonal antibody to LIF Receptor Alpha (CD118) from human, guinea pig and rabbit. Validated for WB.
Human CD118 / LIF Receptor Alpha
Human, Guinea pig, Rabbit (tested or 100% immunogen sequence identity)
Bovine (at least 90% immunogen sequence identity)
Immunogen affinity purified
  • Western blot (0.1 - 0.5 µg/ml)
A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About CD118 / LIF Receptor Alpha
P42702 NM_002310 NP_002301.1

Popular CD118 / LIF Receptor Alpha Products

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemistry - Paraffin Image
Species: Rat
Applications: IHC, Western blot
Immunohistochemistry image at a dilution of 1:600 and staining in paraffin-embedded human lung tissue performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0) . Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4 °C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Mouse
Applications: IHC, Western blot
Immunohistochemistry - Paraffin Image
Species: Mouse
Applications: IHC, Western blot

Publications (0)

Customer Reviews (0)


Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Requested From: United States
Date Requested: 2/16/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy