LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CD118 / LIF Receptor Alpha Antibody (aa863‑899) LS‑C407873
LIF Receptor Alpha antibody LS-C407873 is an unconjugated rabbit polyclonal antibody to LIF Receptor Alpha (CD118) from human, guinea pig and rabbit. Validated for WB.
Catalog
Size
Price
LS-C407873-100
100 µg
$325

Popular CD118 / LIF Receptor Alpha Products

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Western blot of recombinant CD118 / LIFR.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat
Applications: IHC, Western blot
Immunohistochemistry image at a dilution of 1:600 and staining in paraffin-embedded human lung tissue performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0) . Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4 °C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Human
Applications: IHC, IHC - Paraffin, ELISA

Product Description

LIF Receptor Alpha antibody LS-C407873 is an unconjugated rabbit polyclonal antibody to LIF Receptor Alpha (CD118) from human, guinea pig and rabbit. Validated for WB.
About CD118 / LIF Receptor Alpha
CD118 / LIF Receptor Alpha is a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. P42702 NM_002310 NP_002301.1

LIFR Antibody, CD118 Antibody, CD118 antigen Antibody, LIF receptor Antibody, SJS2 Antibody, STWS Antibody, Sws Antibody, LIF-R Antibody


Specifications

Target
Human CD118 / LIF Receptor Alpha
Host
Rabbit
Reactivity
Human, Guinea pig, Rabbit (tested or 100% immunogen sequence identity)
Predicted
Bovine (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
Epitope
aa863-899
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (0)


Customer Reviews (0)


Images

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Western blot

LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.
LIFR antibody Western blot. All lanes: Anti LIFR at 0.5 ug/ml. Lane 1: SW620 Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 190 kD. Observed band size: 190 kD.

Requested From: United States
Date Requested: 9/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy