Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782113-100 100 µg $575 
CCR3 Antibody - Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.

Polyclonal Rabbit anti‑Human CCR3 Antibody (WB) LS‑C782113

Polyclonal Rabbit anti‑Human CCR3 Antibody (WB) LS‑C782113

Antibody:
CCR3 Rabbit anti-Human Polyclonal Antibody
Application:
WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782113-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CCR3 Rabbit anti-Human Polyclonal Antibody
Application:
WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CCR3 antibody LS-C782113 is an unconjugated rabbit polyclonal antibody to CCR3 from human. It is reactive with human, mouse and rat. Validated for Flow and WB.
Target
Human CCR3
Synonyms
CCR3 | C-C chemokine receptor type 3 | B-chemokine receptor | CD193 | CD193 antigen | Chemokine c-c motif receptor 3 | C-C chemokine receptor 3 | CKR3 | CC-CKR-3 | CCR-3 | CMKBR3 | Eosinophil eotaxin receptor | Eotaxin receptor | C-C CKR-3 | CC chemokine receptor 3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.
Applications
  • Western blot (0.5 - 1 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Usage
Optimal dilution of the CCR3 antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCR3
P51677 NM_001837 NP_001828.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2024