Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662564-10 10 µg $318 
LS-C662564-100 100 µg $470 
CCR3 Antibody - Western blot - Anti-CCR3 Picoband antibody
CCR3 Antibody - Flow Cytometry analysis of RAW264. 7 cells using anti-CCR3 antibody. Overlay histogram showing RAW264. 7 cells stained with anti-CCR3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCR3 Antibody - Western blot - Anti-CCR3 Picoband antibody
CCR3 Antibody - Flow Cytometry analysis of RAW264. 7 cells using anti-CCR3 antibody. Overlay histogram showing RAW264. 7 cells stained with anti-CCR3 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CCR3 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human CCR3 Antibody (IHC, WB) LS‑C662564

Polyclonal Rabbit anti‑Human CCR3 Antibody (IHC, WB) LS‑C662564

Antibody:
CCR3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662564-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CCR3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CCR3 antibody LS-C662564 is an unconjugated rabbit polyclonal antibody to human CCR3. Validated for Flow, ICC, IHC and WB.
Target
Human CCR3
Synonyms
CCR3 | C-C chemokine receptor type 3 | B-chemokine receptor | CD193 | CD193 antigen | Chemokine c-c motif receptor 3 | C-C chemokine receptor 3 | CKR3 | CC-CKR-3 | CCR-3 | CMKBR3 | Eosinophil eotaxin receptor | Eotaxin receptor | C-C CKR-3 | CC chemokine receptor 3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
Specificity
In eosinophils as well as trace amounts in neutrophils and monocytes.
Applications
  • IHC
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCR3
P51677 NM_001837 NP_001828.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2024