Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331259-20 20 µl $287 
LS-C331259-50 50 µl $329 
LS-C331259-100 100 µl $407 
LS-C331259-200 200 µl $509 
CBX5 / HP1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human stomach cancer using CBX5 antibody at dilution of 1:200 (400x lens).
CBX5 / HP1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using CBX5 antibody at dilution of 1:200 (400x lens).
CBX5 / HP1 Alpha Antibody - Immunofluorescence analysis of HeLa cells using CBX5 antibody. Blue: DAPI for nuclear staining.
CBX5 / HP1 Alpha Antibody - Western blot analysis of extracts of various cell lines, using CBX5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
CBX5 / HP1 Alpha Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug CBX5 antibody. Western blot was performed from the immunoprecipitate using CBX5 antibodyat a dilition of 1:1000.
CBX5 / HP1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human stomach cancer using CBX5 antibody at dilution of 1:200 (400x lens).
CBX5 / HP1 Alpha Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using CBX5 antibody at dilution of 1:200 (400x lens).
CBX5 / HP1 Alpha Antibody - Immunofluorescence analysis of HeLa cells using CBX5 antibody. Blue: DAPI for nuclear staining.
CBX5 / HP1 Alpha Antibody - Western blot analysis of extracts of various cell lines, using CBX5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
CBX5 / HP1 Alpha Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug CBX5 antibody. Western blot was performed from the immunoprecipitate using CBX5 antibodyat a dilition of 1:1000.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human CBX5 / HP1 Alpha Antibody (IHC, IF, WB) LS‑C331259

Polyclonal Rabbit anti‑Human CBX5 / HP1 Alpha Antibody (IHC, IF, WB) LS‑C331259

Antibody:
CBX5 / HP1 Alpha Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C331259-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CBX5 / HP1 Alpha Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, ChIP-Seq
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
HP1 Alpha antibody LS-C331259 is an unconjugated rabbit polyclonal antibody to HP1 Alpha (CBX5) from human. It is reactive with human, mouse and rat. Validated for ChIP-Seq, IF, IHC, IP and WB.
Target
Human CBX5 / HP1 Alpha
Synonyms
CBX5 | Chromobox homolog 5 | HP1Hs alpha | HP1Hs-alpha | HP1 | HP1 alpha homolog | HP1 alpha | HP1-ALPHA | HP1A | Antigen p25 | Chromobox protein homolog 5
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human CBX5 (NP_001120794.1). MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Specificity
Human CBX5 / HP1 Alpha
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
  • ChIP-sequencing (1:20 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 22kDa, while the observed MW by Western blot was 22kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CBX5 / HP1 Alpha
P45973 NM_012117 NP_036249.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022