LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
C/EBP Epsilon / CEBPE Antibody LS‑C409586
CEBPE antibody LS-C409586 is an unconjugated rabbit polyclonal antibody to CEBPE (C / EBP Epsilon) from human, mouse and rat. Validated for IHC and WB.
Antibody
Catalog
Size
Price
LS-C409586-50
50 µl
$255
LS-C409586-100
100 µl
$315
LS-C409586-200
200 µl
$425

Popular C/EBP Epsilon / CEBPE Products

Anti-C/EBP Epsilon / CEBPE antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B9957 dilution 1:100.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Western blot of HUVEC cell lysate using C/EBP-epsilon Antibody
Species: Human
Applications: IHC, ICC, Immunofluorescence, Western blot
Immunohistochemistry analysis of paraffin-embedded human brain tissue, using C/EBP-epsilon Antibody. The picture on the right is blocked with the synthesized peptide.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Immunohistochemistry analysis of paraffin-embedded human brain, using C/EBP-epsilon (Phospho-Thr74) Antibody. The picture on the right is blocked with the phospho peptide.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Antibody
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA

Product Description

CEBPE antibody LS-C409586 is an unconjugated rabbit polyclonal antibody to CEBPE (C / EBP Epsilon) from human, mouse and rat. Validated for IHC and WB.

Specifications

Target
Human C/EBP Epsilon / CEBPE
Synonyms
CEBPE, CRP1, C/EBP epsilon, C/EBP-epsilon
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CEBPE (NP_001796.2). MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPA
Specificity
Human C/EBP Epsilon / CEBPE
Usage
The predicted MW is 30kDa, while the observed MW by Western blot was 35kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About C/EBP Epsilon / CEBPE
C/EBP Epsilon / CEBPE is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Q15744 NM_001805 NP_001796.2


Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 10/23/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy