Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

BST2 Antibody IHC-plus™ LS-B15391

Note: This antibody replaces LS-C331760
BST2 antibody LS-B15391 is an unconjugated rabbit polyclonal antibody to human BST2. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
50 µl
BST2 antibody LS-B15391 is an unconjugated rabbit polyclonal antibody to human BST2. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Human BST2
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC
  • IHC - Paraffin (1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
BST2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1). NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Human BST2
The predicted MW is 18kDa/19kDa, while the observed MW by Western blot was 36kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About BST2
Q10589 NM_004335 NP_004326.1

Popular BST2 Products

Anti-BST2 antibody IHC of human kidney, glomeruli. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:100.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
Species: Human
Applications: Western blot, ELISA
IHC of BST2 in human liver tissue using BST2 antibody at 5 ug/ml.
Species: Human, Mouse, Rat, Macaque
Applications: IHC, Western blot, Flow Cytometry
Western blot of extracts from Jurkat cells, using BST2 Antibody. The lane on the right is treated with the synthesized peptide.
Species: Human
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Human, Mouse, Rat
Applications: Western blot

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry - Paraffin

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry - Paraffin

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Immunohistochemistry - Paraffin

Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry - Paraffin

Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extract of various cells.
Western blot analysis of extract of various cells.

Requested From: United States
Date Requested: 2/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy