Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

BST2 Antibody IHC-plus™ LS-B15391

Note: This antibody replaces LS-C331760
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of extract of various cells.
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of extract of various cells.
1 of 3
2 of 3
3 of 3

BST2 Antibody IHC-plus™ LS-B15391

Note: This antibody replaces LS-C331760
Rabbit Polyclonal to Human BST2
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human BST2
Unconjugated, Unmodified


BST2 antibody LS-B15391 is an unconjugated rabbit polyclonal antibody to human BST2. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

Human BST2
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC
  • IHC - Paraffin (1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
BST2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1). NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Human BST2
The predicted MW is 18kDa/19kDa, while the observed MW by Western blot was 36kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BST2
Q10589 NM_004335 NP_004326.1


Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Skeletal Muscle, Vessels: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Species: Human
Applications: IHC, IHC - Paraffin
Reactivity: Human
Range: 7.8-500 pmol/ml
Reactivity: Pig
Range: 1.56-100 ng/ml

Requested From: United States
Date Requested: 6/20/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy