LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
BLK Antibody LS‑C349136
BLK antibody LS-C349136 is an unconjugated rabbit polyclonal antibody to BLK from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C349136-50
50 µl
$235
LS-C349136-100
100 µl
$295
LS-C349136-200
200 µl
$385
Description
BLK antibody LS-C349136 is an unconjugated rabbit polyclonal antibody to BLK from human, mouse and rat. Validated for IHC and WB.
Target
Human BLK
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
BLK antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human BLK (NP_001706.2). MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
Specificity
Human BLK
Usage
The predicted MW is 57kDa, while the observed MW by Western blot was 58kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About BLK
P51451 NM_001715 NP_001706.2

Popular BLK Products

Antibody
Species: Human, Mouse
Applications: IHC, Western blot, ELISA
Anti-BLK antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Immunofluorescence of HeLa cells using BLK mouse monoclonal antibody (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry, ELISA
IHC of paraffin-embedded lymph tissue showing membrane location using BLK antibody with DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human breast cancer using antibody at 1:100 dilution.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 12/10/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy