LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
BEST1 / BEST / Bestrophin Antibody LS‑C335598
Bestrophin antibody LS-C335598 is an unconjugated rabbit polyclonal antibody to Bestrophin (BEST1 / BEST) from human and mouse. Validated for WB.
Catalog
Size
Price
LS-C335598-50
50 µl
$235
LS-C335598-100
100 µl
$315
LS-C335598-200
200 µl
$425
Description
Bestrophin antibody LS-C335598 is an unconjugated rabbit polyclonal antibody to Bestrophin (BEST1 / BEST) from human and mouse. Validated for WB.
Target
Human BEST1 / BEST / Bestrophin
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 376-585 of human BEST1 (NP_004174.1). QPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS
Specificity
Human BEST1 / BEST / Bestrophin
Usage
The predicted MW is 57kDa/67kDa/69kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About BEST1 / BEST / Bestrophin
O76090 NM_004183 NP_004174.1

Popular BEST1 / BEST / Bestrophin Products

Bestrophin Antibody (E6-6) - Western blot detection of Bestrophin (68 kDa) from human RPE cell lysate.
Species: Human
Applications: Immunofluorescence, Western blot
Antibody
Species: Human, Mouse, Rat
Applications: Western blot
Western blot - Anti-Bestrophin Picoband antibody
Species: Human
Applications: IHC, ICC, Western blot, Flow Cytometry
Antibody
Species: Human
Applications: IHC, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, ELISA

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 12/16/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy