Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C346375-20 20 µl $215 
LS-C346375-50 50 µl $235 
LS-C346375-100 100 µl $315 
LS-C346375-200 200 µl $425 
ATOX1 Antibody - Immunofluorescence analysis of HeLa cells.

Polyclonal Rabbit anti‑Human ATOX1 Antibody (IHC, IF, WB) LS‑C346375

Polyclonal Rabbit anti‑Human ATOX1 Antibody (IHC, IF, WB) LS‑C346375

Rabbit Polyclonal to Human ATOX1
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


Rabbit Polyclonal to Human ATOX1
Unconjugated, Unmodified


ATOX1 antibody LS-C346375 is an unconjugated rabbit polyclonal antibody to human ATOX1. Validated for IF, IHC and WB.
Human ATOX1
ATOX1 | ATX1 | Copper transport protein ATOX1 | Metal transport protein ATX1 | HAH1
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Human ATOX1
The predicted MW is 7kDa, while the observed MW by Western blot was 7kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ATOX1
O00244 NM_004045 NP_004036.1

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 8/5/2020