Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > ATG14 > LS-C407695
 
Print Page  
Catalog Number Size Price
LS-C407695-10 10 µg $318 
LS-C407695-100 100 µg $470 
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
ATG14 Antibody - ATG14L antibody Western blot. All lanes: Anti ATG14L at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
ATG14 Antibody - Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody. Overlay histogram showing PC-3 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of A431 cells using anti-ATG14L antibody. Overlay histogram showing A431 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody. Overlay histogram showing SiHa cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
ATG14 Antibody - ATG14L antibody Western blot. All lanes: Anti ATG14L at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
ATG14 Antibody - Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody. Overlay histogram showing PC-3 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of A431 cells using anti-ATG14L antibody. Overlay histogram showing A431 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody. Overlay histogram showing SiHa cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human ATG14 Antibody (aa70‑101, IHC, WB) LS‑C407695

Polyclonal Rabbit anti‑Human ATG14 Antibody (aa70‑101, IHC, WB) LS‑C407695

Submit Review LSBio Guarantee
Antibody:
ATG14 Rabbit anti-Human Polyclonal (aa70-101) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407695-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
ATG14 Rabbit anti-Human Polyclonal (aa70-101) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
ATG14 antibody LS-C407695 is an unconjugated rabbit polyclonal antibody to ATG14 (aa70-101) from human. It is reactive with human and rat. Validated for IHC and WB.
Target
Human ATG14
Synonyms
ATG14 | Autophagy related 14 | Beclin 1-Interacting protein | KIAA0831 | ATG14L | BARKOR
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human ATG14L (70-101 aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.
Epitope
aa70-101
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ATG14
Q6ZNE5 AB020638 BAA74854.2

Publications (0)

Submit a Publication for LS-C407695

Customer Reviews (0)

Submit a review for LS-C407695

Featured Products

ATG14 Antibody - Anti-ATG14 antibody IHC staining of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
IHC‑plus™ ATG14 Antibody LS‑B8870
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
ATG14 Antibody
ATG14 Antibody LS‑C490157
Species: Human, Rat
Applications: IHC, IHC - Paraffin, Western blot
ATG14 Antibody - Immunohistochemistry of paraffin-embedded human pancreatic cancer using ATG14 Antibody at dilution of 1:100
ATG14 Antibody LS‑C501091
Species: Human
Applications: IHC, Immunofluorescence, ELISA
ATG14 Antibody - Immunohistochemical analysis of paraffin-embedded testis tissues using ATG14L mouse mAb with DAB staining.
ATG14 Antibody (clone 1F7C10) LS‑C682376
Species: Human
Applications: IHC, Western blot, ELISA
ATG14 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human ATG14 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (aa1-492) - LS-G56780
Source: E. coli
Tag: 10His, N-terminus + Myc, C-terminus
Dermatopontin / DPT Antibody - DPT / Dermatopontin antibody Western blot of Mouse Pancreas lysate. Antibody concentration 1 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Dermatopontin / DPT Antibody (aa45‑94) LS‑C145639
Species: Mouse
Applications: Western blot
See all ATG14 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/29/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com