Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
ATF6 Antibody LS‑C662008
ATF6 antibody LS-C662008 is an unconjugated rabbit polyclonal antibody to human ATF6. Validated for IHC and WB.
100 µg

Popular ATF6 Products

Anti-ATF6 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2564 concentration 10 ug/ml.
Species: Human, Mouse, Rat, Hamster
Applications: IHC, IHC - Paraffin, ICC, Western blot, Chromatin Immunoprecipitation
Anti-ATF6 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2516 concentration 5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, ICC, Western blot
Anti-ATF6 antibody IHC of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2430 concentration 5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, ICC, Western blot, ELISA
Anti-ATF6 antibody IHC of mouse adipose. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B5587 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse, Human, Monkey, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot
Anti-ATF6 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6032 concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Product Description

ATF6 antibody LS-C662008 is an unconjugated rabbit polyclonal antibody to human ATF6. Validated for IHC and WB.
About ATF6
ATF6 is a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. P18850 NM_007348 NP_031374.2

ATF6 Antibody, ATF6-alpha Antibody, ATF6A Antibody


Human ATF6
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
ATF6 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

Immunohistochemistry - Anti-ATF6 Picoband Antibody
Immunohistochemistry - Anti-ATF6 Picoband Antibody

Western blot

Western blot - Anti-ATF6 Picoband Antibody
Western blot - Anti-ATF6 Picoband Antibody

Immunohistochemistry - Paraffin

Immunohistochemistry - Anti-ATF6 Picoband Antibody
Immunohistochemistry - Anti-ATF6 Picoband Antibody

Western blot

Western blot - Anti-ATF6 Picoband Antibody
Western blot - Anti-ATF6 Picoband Antibody

Immunohistochemistry - Paraffin

Immunohistochemistry - Anti-ATF6 Picoband Antibody
Immunohistochemistry - Anti-ATF6 Picoband Antibody

Western blot

Western blot - Anti-ATF6 Picoband Antibody
Western blot - Anti-ATF6 Picoband Antibody

Immunohistochemistry - Paraffin

Immunohistochemistry - Anti-ATF6 Picoband Antibody
Immunohistochemistry - Anti-ATF6 Picoband Antibody

Western blot

Western blot - Anti-ATF6 Picoband Antibody
Western blot - Anti-ATF6 Picoband Antibody

Requested From: United States
Date Requested: 8/17/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy