LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

ASPA Antibody LS-C346318

ASPA antibody LS-C346318 is an unconjugated rabbit polyclonal antibody to ASPA from human, mouse and rat. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C346318-50
50 µl
$235
LS-C346318-100
100 µl
$315
LS-C346318-200
200 µl
$425
Description
ASPA antibody LS-C346318 is an unconjugated rabbit polyclonal antibody to ASPA from human, mouse and rat. Validated for IF, IHC and WB.
Target
Human ASPA
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
ASPA antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human ASPA (NP_001121557.1). MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
Specificity
Human ASPA
Usage
The predicted MW is 35kDa, while the observed MW by Western blot was 36kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About ASPA
P45381 NM_000049 NP_000040.1

Popular ASPA Products

Immunofluorescence of monoclonal antibody to ASPA on HeLa cell . [antibody concentration 10 ug/ml]
Species: Human
Applications: Immunofluorescence, Western blot, ELISA
Anti-ASPA antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 7.5 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, ICC, Western blot
ASPA antibody Western blot of Fetal Kidney lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit
Applications: Western blot
ASPA antibody Western blot of HepG2 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit
Applications: Western blot

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of MCF7 cells.
Immunofluorescence analysis of MCF7 cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of MCF7 cells.
Immunofluorescence analysis of MCF7 cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of MCF7 cells.
Immunofluorescence analysis of MCF7 cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunofluorescence

Immunofluorescence analysis of MCF7 cells.
Immunofluorescence analysis of MCF7 cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 3/22/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy