Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756566-10 10 µg $318 
LS-C756566-100 100 µg $470 
AQP5 / Aquaporin 5 Antibody - IHC analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Aquaporin 5 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-Aquaporin 5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
AQP5 / Aquaporin 5 Antibody - IHC analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Aquaporin 5 was detected in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-Aquaporin 5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
AQP5 / Aquaporin 5 Antibody - Western blot analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat lung tissue lysates,Lane 2: mouse lung tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Aquaporin 5 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Aquaporin 5 at approximately 28KD. The expected band size for Aquaporin 5 is at 28KD.
AQP5 / Aquaporin 5 Antibody - IHC analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Aquaporin 5 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-Aquaporin 5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
AQP5 / Aquaporin 5 Antibody - IHC analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Aquaporin 5 was detected in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml rabbit anti-Aquaporin 5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
AQP5 / Aquaporin 5 Antibody - Western blot analysis of Aquaporin 5 using anti-Aquaporin 5 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat lung tissue lysates,Lane 2: mouse lung tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Aquaporin 5 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Aquaporin 5 at approximately 28KD. The expected band size for Aquaporin 5 is at 28KD.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human AQP5 / Aquaporin 5 Antibody (IHC, WB) LS‑C756566

Polyclonal Rabbit anti‑Human AQP5 / Aquaporin 5 Antibody (IHC, WB) LS‑C756566

Antibody:
AQP5 / Aquaporin 5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756566-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
AQP5 / Aquaporin 5 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Aquaporin 5 antibody LS-C756566 is an unconjugated rabbit polyclonal antibody to Aquaporin 5 (AQP5) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
Target
Human AQP5 / Aquaporin 5
Synonyms
AQP5 | Aquaporin-5 | AQP-5 | Aquaporin 5
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human Aquaporin 5 (NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR).
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AQP5 / Aquaporin 5
P55064 NM_001651 NP_001642.1

LSBio Ratings

AQP5 / Aquaporin 5 Antibody for IHC, WB/Western LS-C756566 has an LSBio Rating of
Publications (4)

Publications (1)

AQP5 enriches for stem cells and cancer origins in the distal stomach. Si Hui Tan , Yada Swathi , Shawna Tan, Jasmine Goh, Ryo Seishima, Kazuhiro Murakami, Masanobu Oshima, Toshikatsu Tsuji, Phyllis Phuah, Liang Thing Tan, Esther Wong, Aliya Fatehullah, Taotao Sheng, Shamaine Wei Ting Ho, Heike I Grabsch, Supriya Srivastava, Ming Teh, Simon L I J Denil, Seri Mustafah, Patrick Tan, Asim Shabbir, Jimmy So, Khay Guan Yeoh, Nick Barker. Nature. 2020 February;578:437-443.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/29/2024