Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331268-20 20 µl $263 
LS-C331268-50 50 µl $289 
LS-C331268-100 100 µl $343 
LS-C331268-200 200 µl $439 
APEX1 / APE1 Antibody - Immunohistochemistry of paraffin-embedded human liver injury using APEX1 antibodyat dilution of 1:100 (40x lens).
APEX1 / APE1 Antibody - Immunofluorescence analysis of HeLa cells using APEX1 antibody. Blue: DAPI for nuclear staining.
APEX1 / APE1 Antibody - Immunofluorescence analysis of A549 cells using APEX1 antibody.
APEX1 / APE1 Antibody - Immunofluorescence analysis of HeLa cells.
APEX1 / APE1 Antibody - Immunofluorescence analysis of A549 cells.
APEX1 / APE1 Antibody - Western blot analysis of extracts of various cell lines, using APEX1 antibody . The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
APEX1 / APE1 Antibody - Western blot analysis of extracts of HeLa cell and HepG2 cells.
APEX1 / APE1 Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells.
APEX1 / APE1 Antibody - Immunohistochemistry of paraffin-embedded human liver injury using APEX1 antibodyat dilution of 1:100 (40x lens).
APEX1 / APE1 Antibody - Immunofluorescence analysis of HeLa cells using APEX1 antibody. Blue: DAPI for nuclear staining.
APEX1 / APE1 Antibody - Immunofluorescence analysis of A549 cells using APEX1 antibody.
APEX1 / APE1 Antibody - Immunofluorescence analysis of HeLa cells.
APEX1 / APE1 Antibody - Immunofluorescence analysis of A549 cells.
APEX1 / APE1 Antibody - Western blot analysis of extracts of various cell lines, using APEX1 antibody . The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
APEX1 / APE1 Antibody - Western blot analysis of extracts of HeLa cell and HepG2 cells.
APEX1 / APE1 Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human APEX1 / APE1 Antibody (IHC, IF, WB) LS‑C331268

Polyclonal Rabbit anti‑Human APEX1 / APE1 Antibody (IHC, IF, WB) LS‑C331268

Antibody:
APEX1 / APE1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331268-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
APEX1 / APE1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
APE1 antibody LS-C331268 is an unconjugated rabbit polyclonal antibody to human APE1 (APEX1). Validated for IF, IHC, IP and WB.
Target
Human APEX1 / APE1
Synonyms
APEX1 | AP endonuclease class I | AP lyase | APE | APE-1 | APEN | APE1 | APEX nuclease | Redox factor-1 | AP endonuclease 1 | APEX | APX | Protein REF-1 | REF-1 | REF1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human APEX1 (NP_542380.1). MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Specificity
Human APEX1 / APE1
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 35kDa, while the observed MW by Western blot was 39kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About APEX1 / APE1
P27695 NM_001641 NP_001632.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022