LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
APBB1 / FE65 Antibody LS‑C490357
FE65 antibody LS-C490357 is an unconjugated rabbit polyclonal antibody to FE65 (APBB1) from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C490357-100
100 µg
$365
Description
FE65 antibody LS-C490357 is an unconjugated rabbit polyclonal antibody to FE65 (APBB1) from human, mouse and rat. Validated for IHC and WB.
Target
Human APBB1 / FE65
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
APBB1 / FE65 antibody was raised against amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Sterile distilled water
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About APBB1 / FE65
O00213 NM_001164 NP_001155.1

Popular APBB1 / FE65 Products

Immunohistochemistry of paraffin-embedded rat lung using APBB1 antibody at dilution of 1:100 (200x lens).
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot
FE65 antibody IHC-paraffin. IHC(P): Rat Brain Tissue.
Species: Human, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human
Applications: Immunofluorescence, Western blot, ELISA
Immunofluorescence analysis of Fe65 was performed using 70% confluent log phase SH-SY5Y cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton X-100 for 10 minutes, and blocked with 1% BSA for 1 hour at room temperature. The cells were labeled with Fe65 Rabbit Polyclonal Antibody at 2 µg/mL in 0.1% BSA and incubated for 3 hours at room temperature and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal Secondary Antibody, Alexa Fluor® 488 conjugate a dilution of 1:2000 for 45 minutes at room temperature (Panel a: green). Nuclei (Panel b: blue) were stained with DAPI. F-actin (Panel c: red) was stained with Alexa Fluor® 555 Rhodamine Phalloidin. Panel d represents the merged image showing cytoplasmic localization. Panel e shows the no primary antibody control. The images were captured at 60X magnification.
Species: Mouse
Applications: Immunofluorescence, Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Western blot

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Immunohistochemistry - Paraffin

Western blot


Requested From: United States
Date Requested: 11/17/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy