Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C187853-0.1 0.1 mg $425 
TLR4 Antibody - Immunohistochemistry of paraffin-embeddedi mouse spleen stained with Goat anti-human CD284
TLR4 Antibody - Immunohistochemistry of paraffin-embeddedi human tonsil stained with Goat anti-human CD284
TLR4 Antibody - Immunohistochemistry of paraffin-embeddedi mouse spleen stained with Goat anti-human CD284
TLR4 Antibody - Immunohistochemistry of paraffin-embeddedi human tonsil stained with Goat anti-human CD284
1 of 2
2 of 2

TLR4 Antibody (aa161‑192) LS‑C187853

TLR4 Antibody (aa161‑192) LS‑C187853

Antibody:
Goat Polyclonal to Human TLR4
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-C187853-0.1
0.1 mg
Toll Free North America
866-819-4732

Overview

Antibody:
Goat Polyclonal to Human TLR4
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TLR4 antibody LS-C187853 is an unconjugated goat polyclonal antibody to human TLR4. Validated for IHC and WB.
Target
Human TLR4
Host
Goat
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100 - 1:300)
  • Western blot (1:1000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-Terminus of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Hamster (87%); Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%); Panda, Cat, Pig (81%).
Epitope
aa161-192
Specificity
Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.
Presentation
PBS, 0.1% Sodium Azide, 0.1% BSA
Storage
Store at 4°C or at -20°C. Store undiluted. Avoid freeze-thaw cycles. Microcentrifugation recommended if solution contains precipitate.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TLR4
O00206 NM_138554 O00206

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 12/7/2019