Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C83988-200 200 µg $475 
Antibody

TLR4 Antibody (aa161‑192) LS‑C83988

TLR4 Antibody (aa161‑192) LS‑C83988

Antibody:
Goat Polyclonal to Human TLR4
Application:
ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$475 
LS-C83988-200
200 µg
Toll Free North America
866-819-4732

Overview

Antibody:
Goat Polyclonal to Human TLR4
Application:
ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TLR4 antibody LS-C83988 is an unconjugated goat polyclonal antibody to human TLR4. Validated for ICC and WB.
Target
Human TLR4
Host
Goat
Reactivity
Human (tested or 100% immunogen sequence identity)
Predicted
Monkey (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • ICC (1:200)
  • Western blot
Immunogen
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-Terminus domain of Human TLR4. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Marmoset (94%); Hamster (87%); Sheep, Goat, Zebu, Bovine (84%); Rat, Dolphin, Panda, Bat, Cat, Pig (81%).
Epitope
aa161-192
Specificity
Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR4, mouse, and rat TLR4.
Presentation
PBS, 1 mg/ml BSA, 0.1% Sodium Azide
Storage
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TLR4
O00206 NM_138554 O00206

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 12/7/2019