LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-STAT3 Antibody (aa688-722) LS-C10382


Wt. Vol. Conc. Price
200 µg - - $530
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular STAT3 Antibodies

Anti-STAT3 Antibody (clone 7G3H4) IHC-plus™ LS-B4102
Mouse Monoclonal [clone 7G3H4] (IgG1) to Human STAT3
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image
Anti-STAT3 Antibody (aa683-732) IHC-plus™ LS-B4693
Rabbit Polyclonal to Human STAT3
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-STAT3 Antibody (C-Terminus) IHC-plus™ LS-B9434
Rabbit Polyclonal to Mouse STAT3
Mouse, Human, Rat
IHC - Paraffin, Western blot, Immunoprecipitation
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human STAT3
Human, Monkey, Mouse, Rat, Bovine, Hamster, Horse, Pig
ICC, Western blot, Immunoprecipitation, Gel shift


Human STAT3
Human, Monkey, Mouse, Rat, Bovine, Hamster, Horse, Pig (tested or 100% immunogen sequence identity)
Sheep (at least 90% immunogen sequence identity)
IgG Polyclonal
Protein A purified


  • ICC (10 µg/ml)
  • Western blot (2 - 4 µg/ml)
  • Immunoprecipitation
  • Gel shift

Specificity and Use

STAT3 antibody was raised against bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).
Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 ug/ml shows positive immunostaining for STAT 3 in A431 cells fixed with 95% ethanol, 5% acetic acid. Immunoprecipitation: 4 ug immunoprecipitates STAT 3 from 500 ug of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.


0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About STAT3

P40763 NM_003150 NP_003141.2

STAT3 Antibody, Acute-phase response factor Antibody, APRF Antibody, DNA-binding protein APRF Antibody, HIES Antibody

STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2.

Requested From: United States
Date Requested: 12/4/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number