Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
STAT3 Antibody (aa688‑722) LS‑C10382
STAT3 antibody LS-C10382 is an unconjugated rabbit polyclonal antibody to STAT3 from human, mouse, rat and other species. Validated for GS, ICC, IP and WB.
200 µg

Popular STAT3 Products

Species: Human, Mouse, Rat
Applications: ICC, Western blot, Immunoprecipitation, Flow Cytometry, ELISA
Formalin-fixed and paraffin-embedded human cancer tissue reacted with the primary antibody, which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated. BC = breast carcinoma; HC = hepatocarcinoma.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Anti-STAT3 antibody IHC of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4102 dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-STAT3 antibody IHC of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4693 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot
Anti-STAT3 antibody IHC staining of human skin. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Mouse, Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation

Product Description

STAT3 antibody LS-C10382 is an unconjugated rabbit polyclonal antibody to STAT3 from human, mouse, rat and other species. Validated for GS, ICC, IP and WB.
About STAT3
STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. P40763 NM_003150 NP_003141.2

STAT3 Antibody, Acute-phase response factor Antibody, APRF Antibody, DNA-binding protein APRF Antibody, HIES Antibody


Human STAT3
Human, Monkey, Mouse, Rat, Bovine, Hamster, Horse, Pig (tested or 100% immunogen sequence identity)
Sheep (at least 90% immunogen sequence identity)
IgG Polyclonal
Unconjugated. Also available conjugated with Biotin, FITC, AF647, CF, PE, AP, APC, Biotin, FITC, HRP, PE.
Protein A purified
  • ICC (10 µg/ml)
  • Western blot (2 - 4 µg/ml)
  • Immunoprecipitation
  • Gel shift
  • (applications tested for the base form of this product only)
STAT3 antibody was raised against bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).
Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 ug/ml shows positive immunostaining for STAT 3 in A431 cells fixed with 95% ethanol, 5% acetic acid. Immunoprecipitation: 4 ug immunoprecipitates STAT 3 from 500 ug of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.
0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 8/16/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number