LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-PKC / Protein Kinase C Antibody (C-Terminus) LS-C17422


Wt. Vol. Conc. Price
200 µg - - Unavailable

Most Popular PKC / Protein Kinase C Antibodies

Anti-PKC / Protein Kinase C Antibody (Thr495) LS-C176455
Rabbit Polyclonal to Human PKC / Protein Kinase C
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot
Immunohistochemistry Image
Anti-PKC / Protein Kinase C Antibody (phospho-Thr497) LS-C199461
Rabbit Polyclonal (IgG) to Human PKC / Protein Kinase C
Human, Mouse, Rat
IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Immunohistochemistry Image
Anti-PKC / Protein Kinase C Antibody (phospho-Thr497) LS-C380817
Rabbit Polyclonal (IgG) to Human PKC / Protein Kinase C
Human, Mouse, Rat
IHC, Immunofluorescence, Western blot, ELISA
Western blot Image
Anti-PKC / Protein Kinase C Antibody (aa600-680) LS-C385520
Rabbit Polyclonal (IgG) to Human PKC / Protein Kinase C
Human, Mouse, Rat
IHC, Immunofluorescence, Western blot, ELISA
Western blot Image
Anti-PKC / Protein Kinase C Antibody (phospho-Thr497) LS-C416574
Rabbit Polyclonal to Human PKC / Protein Kinase C
Human, Mouse, Rat
IHC, ICC, Immunofluorescence, Western blot
Western blot Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human PKC / Protein Kinase C
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Rabbit
Western blot (applications tested for the base form of this product only)


Human PKC / Protein Kinase C
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Rabbit (tested or 100% immunogen sequence identity)
Chicken (at least 90% immunogen sequence identity)
IgG Polyclonal
Unconjugated. Also available conjugated with AP, APC, Biotin, FITC, HRP, MaxLight 405, MaxLight 490, MaxLight 550, MaxLight 650, MaxLight 750, PE.
Protein A purified


  • Western blot
  • (applications tested for the base form of this product only)

Specificity and Use

Synthetic peptide corresponding to amino acids 641-673 of the C-terminus of rabbit Protein Kinase C beta II. [TPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS]. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Horse, Opossum (100%); Platypus (97%); Turkey, Chicken (90%); Xenopus (81%).
Recognizes rabbit Protein Kinase C alpha, beta and gamma isoforms at ~82kD. Species cross-reactivity: human, rat, mouse and bovine.
Western Blot Analysis: 1-2 ug/ml detected ~82kD PKC in RIPA lysates from bovine brain cytosol. Western Blot Analysis Bovine brain cytosol was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-Pan PKC (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system.


0.07 M Tris-glycine, pH 7.4, 0.105 M sodium chloride, 0.035% azide, 30% glycerol.
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About PKC / Protein Kinase C

Requested From: 
Date Requested: 4/23/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number