  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-NPPB / BNP Antibody (aa1-32, clone 13-Jul) LS-C127095

Catalog Size Price
LS-C127095-10 10 µg Unavailable
LS-C127095-100 100 µg Unavailable

Related Products

128 NPPB / BNP Antibodies

Most Popular NPPB / BNP Antibodies

Anti-NPPB / BNP Antibody (clone 43B12) LS-C51844
Mouse Monoclonal [clone 43B12] (IgG2a) to Human NPPB / BNP
Western blot, ELISA
Anti-NPPB / BNP Antibody (clone 26E2) LS-C51849
Mouse Monoclonal [clone 26E2] (IgG1) to Human NPPB / BNP
Western blot, ELISA, Sandwich ELISA
Anti-NPPB / BNP Antibody (clone 3A6F7C7) LS-C82084
Mouse Monoclonal [clone 3A6F7C7] (IgG) to Human NPPB / BNP
IHC - Paraffin
Immunohistochemistry Image
Anti-NPPB / BNP Antibody (clone 57H3) IHC-plus™ LS-B7942
Mouse Monoclonal [clone 57H3] (IgG2a) to Human NPPB / BNP
IHC - Paraffin, Western blot, ELISA, Sandwich ELISA
Immunohistochemistry Image
Anti-NPPB / BNP Antibody (aa27-121) LS-C293059
Rabbit Polyclonal (IgG) to Mouse NPPB / BNP
Western blot, ELISA
Western blot Image

100% Guaranteed
Mouse Monoclonal [clone 13-Jul] (IgG1) to Human NPPB / BNP


Human NPPB / BNP
Human (tested or 100% immunogen sequence identity)
IgG1 Monoclonal [13-Jul]
Protein G purified



Specificity and Use

NPPB / BNP antibody was raised against synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). Percent identity by BLAST analysis: Human, Gibbon (100%).
Recognizes synthetic human Brain Natriuretic Peptide (aa 1-32).
Suitable for use in ELISA.


Lyophilized from PBS, pH 7.2
Distilled water
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About NPPB / BNP

P16860 NM_002521 NP_002512.1

NPPB Antibody, BNP Antibody, Natriuretic peptides B Antibody, Natriuretic peptide B Antibody, Natriuretic protein Antibody, Brain type natriuretic peptide Antibody

NPPB / BNP is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure.

Requested From: 
Date Requested: 8/20/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number