Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
KCNJ4 / Kir2.3 Antibody LS‑C409969
Kir2.3 antibody LS-C409969 is an unconjugated rabbit polyclonal antibody to Kir2.3 (KCNJ4) from mouse and rat. Validated for WB.
50 µl
100 µl
200 µl

Popular KCNJ4 / Kir2.3 Products

Anti-KCNJ4 / Kir2.3 antibody IHC of human brain, cortex neurons. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7460 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation
KCNJ4 / Kir2.3 antibody LS-C110000 Western blot of 293T cell lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat, Dog, Guinea pig, Hamster, Pig, Rabbit
Applications: Western blot
KCNJ4 Antibody western blot of CEM cell line lysates (35 ug/lane). The KCNJ4 antibody detected the KCNJ4 protein (arrow).
Species: Human
Applications: Western blot
Anti-KCNJ4 / Kir2.3 antibody IHC of human liver, hepatocytes. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6727 concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Anti-KCNJ4 / Kir2.3 antibody IHC of human brain, cortex neurons. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B7460 concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation

Product Description

KCNJ4 / Kir2.3 Antibody for WB/Western LS-C409969


Human KCNJ4 / Kir2.3
KCNJ4, IRK3, Kir2.3, HIR, HIRK2, HRK1, IRK-3, Hippocampal inward rectifier
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
KCNJ4 / Kir2.3 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 316-445 of human KCNJ4 (NP_690607.1). HRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
Human KCNJ4 / Kir2.3
The predicted MW is 49kDa, while the observed MW by Western blot was 60kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About KCNJ4 / Kir2.3
Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. P48050 NM_004981 NP_004972.1

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 10/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy