LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-ITGA3 / CD49c Antibody (clone 158A3) LS-C146757

Note: This antibody replaces LS-C147841


Wt. Vol. Conc. Price
100 µg - - $335
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular ITGA3 / CD49c Antibodies

Anti-ITGA3 / CD49c Antibody (aa1040-1051) LS-C15959
Rabbit Polyclonal (IgG) to Human ITGA3 / CD49c
IHC - Frozen, Immunofluorescence, Western blot, Immunoprecipitation, ELISA, Radioimmunoassay
Anti-ITGA3 / CD49c Antibody (N-Terminus) IHC-plus™ LS-A8136
Rabbit Polyclonal to Human ITGA3 / CD49c
Human, Bovine
IHC - Paraffin
Immunohistochemistry Image
Anti-ITGA3 / CD49c Antibody (Internal) IHC-plus™ LS-A8140
Rabbit Polyclonal to Human ITGA3 / CD49c
Human, Monkey
IHC - Paraffin
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone 158A3] (IgG2a) to Human ITGA3 / CD49c
IHC - Frozen, ICC, Western blot


Human ITGA3 / CD49c
Human (tested or 100% immunogen sequence identity)
IgG2a Monoclonal [158A3]


  • IHC - Frozen (1:100 - 1:200)
  • ICC
  • Western blot (1:100 - 1:1000)

  • IHC - Paraffin

Specificity and Use

ITGA3 / CD49c antibody was raised against peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha-3A. A broad species reactivity is expected because of the conserved nature of the epitope.


PBS containing 0.09% sodium azide
Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles. Store undiluted.
For research use only.

About ITGA3 / CD49c

P26006 NM_002204 NP_002195.1

ITGA3 Antibody, Alpha3 integrin Antibody, CD49c antigen Antibody, CD49C Antibody, GAPB3 Antibody, Integrin alpha-3 Antibody, FRP-2 Antibody, VCA-2 Antibody, VLA-3 subunit alpha Antibody, VL3A Antibody, VLA3a Antibody, Galactoprotein B3 Antibody, GAP-B3 Antibody, ILNEB Antibody, Integrin alpha3 Antibody, MSK18 Antibody

ITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.


Immunohistochemistry on frozen sections of dog skin.


Immunohistochemistry on frozen section of human skin

Requested From: United States
Date Requested: 1/16/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number