LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-Integrin Alpha 3B/6B Antibody (clone PB36) LS-C146759

Note: This antibody replaces LS-C147843


Wt. Vol. Conc. Price
100 µg - - $335
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular Integrin Alpha 3B/6B Antibodies

Anti-Integrin Alpha 3B/6B Antibody (Cytoplasmic Domain) LS-C24754
Mouse Monoclonal (IgG1) to Human Integrin Alpha 3B/6B
IHC - Frozen, ICC, Western blot
Anti-Integrin Alpha 3B/6B Antibody (clone PB36) LS-C146759
Mouse Monoclonal [clone PB36] (IgG1) to Human Integrin Alpha 3B/6B
IHC - Frozen, ICC, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone PB36] (IgG1) to Human Integrin Alpha 3B/6B
IHC - Frozen, ICC, Western blot


Human Integrin Alpha 3B/6B
Human (tested or 100% immunogen sequence identity)
IgG1 Monoclonal [PB36]


  • IHC - Frozen (1:50 - 1:100)
  • ICC
  • Western blot (1:100 - 1:500)

  • IHC - Paraffin

Specificity and Use

Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha-3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin
Recognizes the cytoplasmic domain of integrin subunits alpha-3B and alpha-6B. Reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. A broad species reactivity is expected because of the conserved nature of the epitope.


PBS containing 0.09% sodium azide
Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles. Store undiluted.
For research use only.

About Integrin Alpha 3B/6B


Immunohistochemistry on frozen section of human kidney

Requested From: United States
Date Requested: 1/22/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number