LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-INHBC Antibody (aa82-113, clone betaC clone 1) LS-C188331

Wt. Vol. Conc. Price
100 µg - 0.5 mg/ml $370
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular INHBC Antibodies

Anti-INHBC Antibody (aa237-352) LS-C122593
Goat Polyclonal (IgG) to Human INHBC
IHC, ICC, Immunofluorescence, Western blot, Immunoprecipitation, Flow Cytometry, ELISA, Radioimmunoassay
Anti-INHBC Antibody (aa237-352) LS-C124884
Mouse Monoclonal (IgG1) to Human INHBC
Western blot, ELISA
Anti-INHBC Antibody (aa237-352, FITC) LS-C303520
Rabbit Polyclonal (IgG) to Mouse INHBC
Western blot, ELISA
FITC Conjugated
Western blot Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone betaC clone 1] (IgG1) to Human INHBC
Human, Hamster
IHC - Paraffin, Western blot, ELISA

Human, Hamster (tested or 100% immunogen sequence identity)
Monkey, Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit (at least 90% immunogen sequence identity)
IgG1 Monoclonal [betaC clone 1]
Protein G purified

  • IHC - Paraffin
  • Western blot (1:5000)

Specificity and Use

INHBC antibody was raised against synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Ferret, Hamster, Elephant, Panda, Cat, Opossum (100%); Marmoset, Mouse, Rat, Bovine, Dog, Pig (97%); Galago, Rabbit, Horse (94%); Turkey (90%); Zebra finch (87%); Guinea pig (84%); Orangutan (81%).
Specific for the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways. Activins were originally characterized by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC). The antibody has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaAf, BetaB or BetaE.

PBS, 0.09% sodium azide
+4°C or -20°C, Avoid repeated freezing and thawing.
For research use only.

P55103 NM_005538 NP_005529.1

INHBC Antibody, Activin beta-C chain Antibody, IHBC Antibody, Inhibin, beta C Antibody, Inhibin beta c chain Antibody

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition.

Requested From: United States
Date Requested: 10/27/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number