Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IL7R / CD127 Antibody LS‑C662418
CD127 antibody LS-C662418 is an unconjugated rabbit polyclonal antibody to human CD127 (IL7R). Validated for WB.
100 µg
CD127 antibody LS-C662418 is an unconjugated rabbit polyclonal antibody to human CD127 (IL7R). Validated for WB.
Human IL7R / CD127
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • Western blot
IL7R / CD127 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About IL7R / CD127
P16871 NM_002185 NP_002176.2

Popular IL7R / CD127 Products

Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Mouse, Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Mouse, Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Flow cytometry of IL7R / CD127 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Flow Cytometry
Immunohistochemistry of paraffin-embedded human rectal cancer using antibody at 1:100 dilution.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot - Anti-IL7R/CD127 Picoband Antibody
Western blot - Anti-IL7R/CD127 Picoband Antibody

Western blot

Western blot - Anti-IL7R/CD127 Picoband Antibody
Western blot - Anti-IL7R/CD127 Picoband Antibody

Western blot

Western blot - Anti-IL7R/CD127 Picoband Antibody
Western blot - Anti-IL7R/CD127 Picoband Antibody

Western blot

Western blot - Anti-IL7R/CD127 Picoband Antibody
Western blot - Anti-IL7R/CD127 Picoband Antibody

Requested From: United States
Date Requested: 12/10/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy