  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-IL7R / CD127 Antibody LS-C662418

Catalog Size Price
LS-C662418-100 100 µg Unavailable

Related Products

81 IL7R / CD127 Antibodies

Most Popular IL7R / CD127 Antibodies

Anti-IL7R / CD127 Antibody (C-Terminus) IHC-plus™ LS-B2830
Rabbit Polyclonal to Mouse IL7R / CD127
Mouse, Human, Rat
IHC - Paraffin, Western blot, ELISA
Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2830 concentration 5 ug/ml.
Anti-IL7R / CD127 Antibody (phospho-Tyr449) IHC-plus™ LS-B2831
Rabbit Polyclonal to Mouse IL7R / CD127
Mouse, Human, Rat
IHC - Paraffin, Western blot, ELISA
Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2831 concentration 5 ug/ml.
Anti-IL7R / CD127 Antibody (clone ANC8F2, RPE) LS-C134720
Mouse Monoclonal [clone ANC8F2] (IgG1,k) to Human IL7R / CD127
Flow Cytometry
RPE Conjugated
Flow cytometry of IL7R / CD127 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Anti-IL7R / CD127 Antibody (aa21-239) LS-C375967
Rabbit Polyclonal (IgG) to Human IL7R / CD127
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human rectal cancer using antibody at 1:100 dilution.
Anti-IL7R / CD127 Antibody IHC-plus™ LS-B14308
Rabbit Polyclonal (IgG) to Human IL7R / CD127
Human, Mouse, Rat
IHC, IHC - Paraffin, Immunofluorescence, Western blot
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

100% Guaranteed
Rabbit Polyclonal to Human IL7R / CD127
Western blot


Human IL7R / CD127
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified


Western blot

Specificity and Use

IL7R / CD127 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.


5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
For research use only.

About IL7R / CD127

P16871 NM_002185 NP_002176.2

IL7R Antibody, CD127 Antibody, CD127 antigen Antibody, IL-7RA Antibody, IL-7 receptor subunit alpha Antibody, IL7RA Antibody, ILRA Antibody, Interleukin 7 receptor Antibody, CDW127 Antibody, IL-7R subunit alpha Antibody, IL-7R-alpha Antibody

IL7R / CD127 is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation.

Western blot

Western blot - Anti-IL7R/CD127 Picoband Antibody
Western blot - Anti-IL7R/CD127 Picoband Antibody

Requested From: 
Date Requested: 4/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number