Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
IL7R / CD127 Antibody LS‑C490654
CD127 antibody LS-C490654 is an unconjugated rabbit polyclonal antibody to CD127 (IL7R) from human and rat. Validated for WB.
100 µg

Popular IL7R / CD127 Products

Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2830 concentration 5 ug/ml.
Species: Mouse, Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-IL-7 Receptor antibody IHC of human colon, MALT. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B2831 concentration 5 ug/ml.
Species: Mouse, Human, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Flow cytometry of IL7R / CD127 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Flow Cytometry
Immunohistochemistry of paraffin-embedded human rectal cancer using antibody at 1:100 dilution.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Product Description

CD127 antibody LS-C490654 is an unconjugated rabbit polyclonal antibody to CD127 (IL7R) from human and rat. Validated for WB.
About IL7R / CD127
IL7R / CD127 is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. P16871 NM_002185 NP_002176.2

IL7R Antibody, CD127 Antibody, CD127 antigen Antibody, IL-7RA Antibody, IL-7 receptor subunit alpha Antibody, IL7RA Antibody, ILRA Antibody, Interleukin 7 receptor Antibody, CDW127 Antibody, IL-7R subunit alpha Antibody, IL-7R-alpha Antibody


Human IL7R / CD127
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
IL7R / CD127 antibody was raised against amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot

Western blot

Western blot

Requested From: United States
Date Requested: 9/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy