LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-IL21 Antibody (aa33-61) LS-C83971

Note: This antibody replaces LS-C8217, LS-C70984


Wt. Vol. Conc. Price
100 µg - 1 mg/ml $455
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular IL21 Antibodies

Anti-IL21 Antibody (Internal) IHC-plus™ LS-B1364
Rabbit Polyclonal to Human IL21
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-IL21 Antibody (Biotin) LS-C104548
Rabbit Polyclonal to Mouse IL21
Western blot, ELISA
Biotin Conjugated
Enzyme-Linked Immunosorbent Assay Image

100% Guaranteed 100% Guaranteed
Goat Polyclonal to Mouse IL21


Mouse IL21
Mouse (tested or 100% immunogen sequence identity)
Rat (at least 90% immunogen sequence identity)
Immunoaffinity purified


  • IHC (1:500)
  • ELISA (1:100000)

Specificity and Use

IL21 antibody was raised against synthetic peptide C-RHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21. Percent identity by BLAST analysis: Mouse (100%); Rat (93%); Hamster (86%).
Peptide sequence is <50 % identical to other interleukins in this region. The antibody recognizes mouse IL-21. Not tested for cross-reactivity to human IL-21.


10 mM KHPO4, 140 mM NaCl. with 0.1% sodium azide
Long term: -70°C; Short term: -20°C; Avoid freeze-thaw cycles.
For research use only.

About IL21

Q9HBE4 NM_021803 NP_068575.1

IL21 Antibody, Interleukin 21 Antibody, Interleukin-21 Antibody, Interleukin-21 isoform Antibody, Za11 Antibody, IL-21 Antibody

Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells.


IHC of IL-21 antibody LS-C83971. Mouse spleen.

Requested From: United States
Date Requested: 1/24/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number