LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-HMOX1 / HO-1 Antibody (aa1-30) LS-C15741

Wt. Vol. Conc. Price
50 µg - - $375
200 µg - - $495
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular HMOX1 / HO-1 Antibodies

Anti-HMOX1 / HO-1 Antibody IHC-plus™ LS-B3421
Rabbit Polyclonal to Human HMOX1 / HO-1
Human, Monkey, Mouse, Rat, Dog, Hamster, Rabbit
IHC - Paraffin, Western blot, Immunoprecipitation
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human HMOX1 / HO-1
Human, Bat
Western blot, Immunoprecipitation

Human HMOX1 / HO-1
Human, Bat (tested or 100% immunogen sequence identity)
Monkey, Mouse (at least 90% immunogen sequence identity)
IgG Polyclonal

  • Western blot (1:2500)
  • Immunoprecipitation (1:100)

Specificity and Use

HMOX1 / HO-1 antibody was raised against synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
Suitable for use in Western Blot and Immunoprecipitation. Western Blot (ECL): 1:1000. Immunoprecipitation: 1:100.

PBS, 0.09% azide, 50% glycerol.
Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
For research use only.

About HMOX1 / HO-1

P09601 NM_002133 NP_002124.1

HMOX1 Antibody, BK286B10 Antibody, HO-1 Antibody, HSP32 Antibody, Heat shock protein, 32-kD Antibody, Heme oxygenase (decycling) 1 Antibody, Heme oxygenase 1 Antibody, HO1 Antibody

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

Requested From: United States
Date Requested: 10/21/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number