LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-DEFB1 / BD-1 Antibody (aa1-36, clone M4-14B-H4) LS-C127008


Wt. Vol. Conc. Price
10 µg - - $395
100 µg - - $815
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular DEFB1 / BD-1 Antibodies

Anti-DEFB1 / BD-1 Antibody (N-Terminus) LS-C20901
Rabbit Polyclonal (IgG) to Mouse DEFB1 / BD-1
Western blot, ELISA
Anti-DEFB1 / BD-1 Antibody (aa2-64) LS-C372723
Rabbit Polyclonal (IgG) to Bovine DEFB1 / BD-1
Western blot, ELISA
Western blot Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone M4-14B-H4] (IgG1) to Human DEFB1 / BD-1
Western blot, ELISA


Human DEFB1 / BD-1
Human (tested or 100% immunogen sequence identity)
Monkey (at least 90% immunogen sequence identity)
IgG1 Monoclonal [M4-14B-H4]
Protein G purified


  • Western blot (1:1000 - 1:2000)

Specificity and Use

DEFB1 / BD-1 antibody was raised against synthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). Percent identity by BLAST analysis: Human, Orangutan (100%); Chimpanzee, Gorilla (97%); Gibbon, Monkey (90%); Baboon (87%); Tamarin (84%); Marmoset (81%).
Recognizes human beta-Defensin 1 (epitope: aa 1-36).
Suitable for use in ELISA and Western Blot. Western Blot: 1:1000-1:2000.


Lyophilized from 50 mM Tris, pH 7.4
Sterile buffer or distilled water
Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About DEFB1 / BD-1

P60022 NM_005218 NP_005209.1

DEFB1 Antibody, BD1 Antibody, Beta-defensin 1 Antibody, BD-1 Antibody, Beta Defensin 1 Antibody, DEFB-1 Antibody, DEFB101 Antibody, Defensin, beta 1 Antibody, Defensin beta Antibody, HBD-1 Antibody, Beta-defensin-1 Antibody, HBD1 Antibody

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis.

Requested From: United States
Date Requested: 2/25/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number