LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-AMH / Anti-Mullerian Hormone Antibody (clone 5/6) LS-C188251

Note: This antibody replaces LS-C121384


Wt. Vol. Conc. Price
- 1000 µl - $765
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular AMH / Anti-Mullerian Hormone Antibodies

Anti-AMH / Anti-Mullerian Hormone Antibody LS-C136839
Rabbit Polyclonal (IgG) to Human AMH / Anti-Mullerian Hormone
Western blot, ELISA
Western blot Image
Anti-AMH / Anti-Mullerian Hormone Antibody (aa468-517) IHC-plus™ LS-B4020
Rabbit Polyclonal (IgG) to Human AMH / Anti-Mullerian Hormone
Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Pig
IHC - Paraffin, Western blot
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Mouse Monoclonal [clone 5/6] (IgG1) to Human AMH / Anti-Mullerian Hormone
Human, Monkey, Mouse, Pig
IHC - Paraffin, Western blot


Human AMH / Anti-Mullerian Hormone
Human, Monkey, Mouse, Pig (tested or 100% immunogen sequence identity)
Rat, Bovine, Dog, Guinea pig (at least 90% immunogen sequence identity)
IgG1 Monoclonal [5/6]
Tissue culture supernatant


  • IHC - Paraffin (1:20 - 1:40)
  • Western blot

Specificity and Use

AMH / Anti-Mullerian Hormone antibody was raised against synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Pig (100%); Panda, Dog, Bovine (97%); Rat, Guinea pig (94%).
Is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. Plays a role in testicular differentiation and in the regulation of ovarian follicle growth. Is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.


Tissue culture supernatant, 0.09% sodium azide
+4°C or -20°C, Avoid repeated freezing and thawing.
For research use only.

About AMH / Anti-Mullerian Hormone

P03971 NM_000479 NP_000470.2

AMH Antibody, Anti-Muellerian hormone Antibody, Anti-Mullerian hormone Antibody, Muellerian-inhibiting factor Antibody, Mullerian inhibiting factor Antibody, Mullerian inhibiting substance Antibody, MIS Antibody

Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.

Requested From: United States
Date Requested: 1/19/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number