Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782971-100 100 µg $575 
ALOX12 / 12 Lipoxygenase Antibody - Western blot testing of 1) rat spleen, 2) mouse spleen and 3) human COLO320 lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.

Polyclonal Rabbit anti‑Human ALOX12 / 12 Lipoxygenase Antibody (WB) LS‑C782971

Polyclonal Rabbit anti‑Human ALOX12 / 12 Lipoxygenase Antibody (WB) LS‑C782971

Antibody:
ALOX12 / 12 Lipoxygenase Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782971-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ALOX12 / 12 Lipoxygenase Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
12 Lipoxygenase antibody LS-C782971 is an unconjugated rabbit polyclonal antibody to 12 Lipoxygenase (ALOX12) from human. It is reactive with human, mouse and rat. Validated for WB.
Target
Human ALOX12 / 12 Lipoxygenase
Synonyms
ALOX12 | 12S-lipoxygenase | 12-lipoxygenase | 12S-LOX | 12(S)-lipoxygenase | 12-LOX | 12 Lipoxygenase | Arachidonate 12-lipoxygenase | LOG12 | Platelet 12-LOX | Platelet-type 12-lipoxygenase | Platelet-type lipoxygenase 12
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.
Applications
  • Western blot (0.5 - 1 µg/ml)
Usage
Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ALOX12 / 12 Lipoxygenase
P18054 NM_000697 NP_000688.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/15/2024