Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13191-50 50 µl (0.5 mg/ml) $460 
AICDA / AID Antibody - Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)

Polyclonal Rabbit anti‑Human AICDA / AID Antibody (IHC) LS‑B13191

Polyclonal Rabbit anti‑Human AICDA / AID Antibody (IHC) LS‑B13191

Note: This antibody replaces LS-C359165
Antibody:
AICDA / AID Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13191-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
AICDA / AID Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P
Format:
Unconjugated, Unmodified

Specifications

Description
AID antibody LS-B13191 is an unconjugated rabbit polyclonal antibody to AID (AICDA) from human. Validated for IHC.
Target
Human AICDA / AID
Synonyms
AICDA | AID | ARP2 | CDA2 | Cytidine aminohydrolase | HIGM2
Host
Rabbit
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Immunogen
Synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Applications
  • IHC
  • IHC - Paraffin (10 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
PBS, 0.09% sodium azide, 2% sucrose
Storage
Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AICDA / AID
Q9GZX7 NM_020661 NP_065712.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/29/2024