Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C783005-100 100 µg $575 
AHR Antibody - IHC staining of FFPE rat small intestine with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE rat spleen with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE mouse liver with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human tonsil with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human esophagus squamous cancer with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human cholangiocarcinoma with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human placenta with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - Western blot testing of human recombinant partial protein with AHR antibody.
AHR Antibody - IHC staining of FFPE rat small intestine with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE rat spleen with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE mouse liver with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human tonsil with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human esophagus squamous cancer with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human cholangiocarcinoma with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - IHC staining of FFPE human placenta with AHR antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AHR Antibody - Western blot testing of human recombinant partial protein with AHR antibody.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human AHR Antibody (IHC, WB) LS‑C783005

Polyclonal Rabbit anti‑Human AHR Antibody (IHC, WB) LS‑C783005

Antibody:
AHR Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C783005-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
AHR Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
AHR antibody LS-C783005 is an unconjugated rabbit polyclonal antibody to AHR from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
Target
Human AHR
Synonyms
AHR | Ah receptor | AH-receptor | Aryl hydrocarbon receptor | BHLHe76 | Aromatic hydrocarbon receptor
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH were used as the immunogen for the AHR antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the AHR antibody should be determined by the researcher.
Presentation
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AHR
P35869 NM_001621 NP_001612.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/21/2024