Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C747201-20 20 µl $275 
LS-C747201-100 100 µl $389 
Antibody

Polyclonal Rabbit anti‑Human ADGRB2 / BAI2 Antibody (WB) LS‑C747201

Polyclonal Rabbit anti‑Human ADGRB2 / BAI2 Antibody (WB) LS‑C747201

Antibody:
ADGRB2 / BAI2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C747201-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ADGRB2 / BAI2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
BAI2 antibody LS-C747201 is an unconjugated rabbit polyclonal antibody to human BAI2 (ADGRB2). Validated for WB.
Target
Human ADGRB2 / BAI2
Synonyms
ADGRB2 | BAI2
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ADGRB2 (NP_001281264.1). DFIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATSGAAGSPGRGRGPGTVPPGPGHSH
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 169kDa/171kDa/172kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ADGRB2 / BAI2
O60241 NM_001703 BAA25362.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/18/2024