Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C747652-20 20 µl $287 
LS-C747652-50 50 µl $341 
LS-C747652-100 100 µl $431 
LS-C747652-200 200 µl $539 
ABCF2 Antibody - Immunohistochemistry of paraffin-embedded mouse brain using ABCF2 antibody at dilution of 1:100 (40x lens).
ABCF2 Antibody - Immunohistochemistry of paraffin-embedded rat brain using ABCF2 antibody at dilution of 1:100 (40x lens).
ABCF2 Antibody - Immunofluorescence analysis of U2OS cells using ABCF2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
ABCF2 Antibody - Western blot analysis of extracts of various cell lines, using ABCF2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
ABCF2 Antibody - Immunohistochemistry of paraffin-embedded mouse brain using ABCF2 antibody at dilution of 1:100 (40x lens).
ABCF2 Antibody - Immunohistochemistry of paraffin-embedded rat brain using ABCF2 antibody at dilution of 1:100 (40x lens).
ABCF2 Antibody - Immunofluorescence analysis of U2OS cells using ABCF2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
ABCF2 Antibody - Western blot analysis of extracts of various cell lines, using ABCF2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human ABCF2 Antibody (IHC, IF, WB) LS‑C747652

Polyclonal Rabbit anti‑Human ABCF2 Antibody (IHC, IF, WB) LS‑C747652

Antibody:
ABCF2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C747652-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ABCF2 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
ABCF2 antibody LS-C747652 is an unconjugated rabbit polyclonal antibody to ABCF2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human ABCF2
Synonyms
ABCF2 | ABC-type transport protein | ABC28 | EST133090 | M-ABC1 | HUSSY18 | HUSSY-18
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2). MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFML
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 71kDa/72kDa, while the observed MW by Western blot was 75kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ABCF2
Q9UG63 NM_005692 NP_005683.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/18/2024