Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782184-100 100 µg $575 
ABCB1 / MDR1 / P Glycoprotein Antibody - Western blot testing of human 1) THP-1 and 2) A375 cell lysate with P Glycoprotein antibody at 0.5ug/ml. Expected molecular weight: 141-180 kDa depending on glycosylation level.

Polyclonal Rabbit anti‑Human ABCB1 / MDR1 / P Glycoprotein Antibody (WB) LS‑C782184

Polyclonal Rabbit anti‑Human ABCB1 / MDR1 / P Glycoprotein Antibody (WB) LS‑C782184

Antibody:
ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782184-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ABCB1 / MDR1 / P Glycoprotein Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
P Glycoprotein antibody LS-C782184 is an unconjugated rabbit polyclonal antibody to human P Glycoprotein (ABCB1 / MDR1). Validated for WB.
Target
Human ABCB1 / MDR1 / P Glycoprotein
Synonyms
ABCB1 | ABC20 | Abcb1b | CLCS | Colchicin sensitivity | CD243 | IBD13 | gp170 | MDR1 | Multidrug resistance protein 1 | P glycoprotein | P-glycoprotein 1 | P-GP | CD243 antigen | PGY1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Protein A affinity chromatography
Modifications
Unmodified
Immunogen
Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY were used as the immunogen for the P Glycoprotein antibody.
Applications
  • Western blot (0.5 - 1 µg/ml)
Usage
Optimal dilution of the P Glycoprotein antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ABCB1 / MDR1 / P Glycoprotein
P08183 NM_000927 NP_000918.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2024