Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
CLEC7A / Dectin 1 Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G103917-100
Catalog Number: LS-G103917
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human Dectin 1(CLEC7A) (NM_197954), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- BGR | CANDF4 | CLECSF12 | Dectin-1 | DC-associated C-type lectin 1 | DECTIN1 | CLEC7A | HDectin-1 | Beta-glucan receptor | Lectin-like receptor 1 | CD369
- Origin Species
- Human
- NCBI GenBank
- NM_022570
- SwissProt
- Q9BXN2
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 8.2 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL GILCLVILVI61AVVLGTMAGF KAVEFKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
77 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.