RBX1 / ROC1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490470-100
Catalog Number: LS-C490470
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ROC1 antibody LS-C490470 is an unconjugated rabbit polyclonal antibody to ROC1 (RBX1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- RBX1 | Regulator of cullins 1 | RING box protein 1 | ROC1 | TESTICAN | Ring-box 1 | RNF75 | BA554C12.1 | Protein ZYP | RING finger protein 75 | RING-box protein 1 | ZYP protein
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P62877
- NCBI GenBank
- NM_014248 | NP_055063.1
- SwissProt
- P62877
Target
- Target
- Human RBX1 / ROC1
- Antigen Species
- Human
- Gene Name
- RBX1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH of human ROC1/RBX1 were used as the immunogen for the RBX1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS