ROC1 antibody Western blot. All lanes: Anti ROC1 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Predicted band size: 15 kD. Observed band size: 15 kD.
RBX1 / ROC1 Antibody (aa76-108)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Arthropod (Insect / Arachnid / Crustacean), Bovine, Chicken, Fruit Fly, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Rat, Sheep, Zebrafish |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408010-100
Catalog Number: LS-C408010
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ROC1 antibody LS-C408010 is an unconjugated rabbit polyclonal antibody to ROC1 (RBX1) (aa76-108) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Arth, Bov, Ck, Dros, GP, Hr, Hu, Mml, Ms, Rt, Sh, Zf
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- RBX1 | Regulator of cullins 1 | RING box protein 1 | ROC1 | TESTICAN | Ring-box 1 | RNF75 | BA554C12.1 | Protein ZYP | RING finger protein 75 | RING-box protein 1 | ZYP protein
- UniProt Number
- P62877
- NCBI GenBank
- NM_014248 | NP_055063.1
- SwissProt
- P62877
Target
- Target
- Human RBX1 / ROC1
- Antigen Species
- Human
- Epitope
- Widely expressed.
- Gene Name
- RBX1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ROC1 (76-108 aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl