Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of various cell lines.
Polyclonal Rabbit anti-Human GZMB / Granzyme B Antibody (IF, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C332166-20
Catalog Number: LS-C332166
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Granzyme B antibody LS-C332166 is an unconjugated rabbit polyclonal antibody to Granzyme B (GZMB) from human. It is reactive with human and mouse. Validated for IF and WB.
- Application
- IF, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CCPI | CGL-1 | Cathepsin G-like 1 | CSP-B | CTLA-1 | CTLA1 | CGL1 | CSPB | Fragmentin 2 | GRB | HLP | Human lymphocyte protein | Fragmentin-2 | GZMB | SECT | Lymphocyte protease | T-cell serine protease 1-3E | C11 | CTSGL1 | Cytotoxic serine protease B | Granzyme B | Granzyme-2
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P10144
- NCBI GenBank
- NM_004131 | NP_004122.2
- SwissProt
- P10144
Target
- Target
- Human GZMB / Granzyme B
- Antigen Species
- Human
- Epitope
- Human GZMB / Granzyme B
- Gene Name
- GZMB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human GZMB (NP_004122.2). GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
