Peptide YY / PYY Antibody
Catalog Number: LS-C184083-100
100 µL / $878.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general)
Reactivity: Dog, Mouse, Pig, Rat
Format: Lyophilized
Immunohistochemistry: De-waxed section of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to PYY. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.
Peptide YY / PYY Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Format: | Liquid |
$565.00each
Catalog Number: LS-C343848-100
Catalog Number: LS-C343848
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PYY antibody LS-C343848 is an unconjugated rabbit polyclonal antibody to PYY (Peptide YY) from all species. Validated for IHC and WB.
- Application
- IHC, WB
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Peptide tyrosine tyrosine | PYY1 | Peptide YY | PYY-I | PYY
- Recommended Dilution: WB
- 1:1000
- UniProt Number
- P10082
- NCBI GenBank
- NM_004160 | NP_004151.3
- SwissProt
- P10082
Target
- Target
- All species Peptide YY / PYY
- Antigen Species
- Pan-species / Cross-reactive
- Gene Name
- PYY
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- Antiserum, 0.1% sodium azide
- Volume
- 100 Microliter
- Preservative
- Yes
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
