Peptide YY / PYY Antibody
Catalog Number: LS-C343848-100
100 µL / $565.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Format: Liquid
Western blot - Anti-Peptide YY Picoband Antibody
Peptide YY / PYY Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662302-100
Catalog Number: LS-C662302
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PYY antibody LS-C662302 is an unconjugated rabbit polyclonal antibody to mouse PYY (Peptide YY). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Peptide tyrosine tyrosine | PYY1 | Peptide YY | PYY-I | PYY
- UniProt Number
- P10082
- NCBI GenBank
- NM_004160 | NP_004151.3
- SwissProt
- P10082
Target
- Target
- Mouse Peptide YY / PYY
- Antigen Species
- Mouse
- Gene Name
- PYY
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64 aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
