IHC staining of FFPE mouse small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Peptide YY / PYY Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin
Reactivity:	Mouse, Rat
Format:	Lyophilized

See all Mouse Peptide YY / PYY antibodies â†’

$587.00each

Catalog Number: LS-C782268-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PYY antibody LS-C782268 is an unconjugated rabbit polyclonal antibody to PYY (Peptide YY) from mouse. It is reactive with mouse and rat. Validated for IHC.
Application: IHC-P
Reactivity: Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Peptide tyrosine tyrosine | PYY1 | Peptide YY | PYY-I | PYY
Recommended Dilution: IHC-P: 1 - 2 µg/ml
UniProt Number: P10082
NCBI GenBank: NM_004160 | NP_004151.3
SwissProt: P10082

Target

Target: Mouse Peptide YY / PYY
Antigen Species: Mouse
Gene Name: PYY

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY were used as the immunogen for the Peptide YY antibody.
Immunogen Type: Peptide

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: 1X PBS

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.