Western blot analysis of extracts of various cell lines, using PAPSS1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

PAPSS 1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C748803-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PAPSS 1 antibody LS-C748803 is an unconjugated rabbit polyclonal antibody to PAPSS 1 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ATPSK1 | PAPS synthase 1 | SK1 | PAPSS 1 | SK 1 | Sulfurylase kinase 1 | Paps synthetase | PAPSS | PAPSS1
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O43252
NCBI GenBank: NM_005443, NP_005434.4
SwissProt: O43252

Target

Target: Human PAPSS 1
Antigen Species: Hu
Gene Name: PAPSS1

Antibody

Host Species: Rb
Clonality: Polyclonal
Isotype: IgG
Origin Species: Hu

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-260 of human PAPSS1 (NP_005434.4). SEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKIN
Immunogen Type: Fusion-P