Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of MADCAM1 antibody in HeLa cell lysate. Predicted molecular weight ~40 kDa.
MAdCAM-1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782186-100
Catalog Number: LS-C782186
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MAdCAM-1 antibody LS-C782186 is an unconjugated rabbit polyclonal antibody to human MAdCAM-1. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HMAdCAM-1 | MACAM1 | MAdCAM-1 | MADCAM1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q13477
- NCBI GenBank
- AAC51354.1 | NM_130762
- SwissProt
- Q13477
Target
- Target
- Human MAdCAM-1
- Antigen Species
- Human
- Gene Name
- MADCAM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL were used as the immunogen for this MADCAM1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
